Monthly Hosting Agreement
Web, Domain & Email Hosting Monthly Package
We will:
- Host two domains (woodlandparkfamilyfamilymedicine.com and wpfamilymedicine.com) and up to five websites. Additional domains and websites will incur an additional fee.
- Renew the woodlandparkfamilymedicine.com and wpfamilymedicine.com domains on a yearly basis through our preferred domain registrar.
- Provide up to 60 regular and 60 forwarding emails (name@yourwebsite.com). Additional emails will incur an additional fee.
- Provide CPanel access to your hosting account for your webmaster and technical assistants.
- Assist in the one-time transfer of emails for woodlandparkfamilymedicine.com/wpfamilymedicine.com from one server to another and provide a tutorial for your technical assistant on setting up and deleting email addresses.
- Charge you $100/month for this service.
You will:
- Pay us $100.00 per month via credit/debit card on an automatically recurring basis, agreeing to the terms above. Payment collected by Marcum Group Media, Bellandi Group South’s parent company.
- Appoint Bellandi Group South as your representative with full access to your hosting, domains, website and email technical records, including passwords and usernames, only as necessary.
- Agree to notify us with sixty days notice to cancel this agreement.